Protein Info for BWI76_RS01815 in Klebsiella michiganensis M5al

Annotation: phosphate-starvation-inducible protein PsiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details PF06146: PsiE" amino acids 19 to 130 (112 residues), 79.3 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 93% identical to PSIE_KLEP7: Protein PsiE homolog (psiE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K13256, protein PsiE (inferred from 94% identity to kpe:KPK_5256)

Predicted SEED Role

"PsiE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AWB6 at UniProt or InterPro

Protein Sequence (136 amino acids)

>BWI76_RS01815 phosphate-starvation-inducible protein PsiE (Klebsiella michiganensis M5al)
MPPVYRPLVSFIATAMQTVLNLGLLCLGVILIVFLGKETLHLAHVLFTPEPVSKYKLVEG
LVVYFLYFEFIALIVKYFESGFHFPLRYFVYIGITAIVRLIIIDHESPMAVLIYSAAILI
LVITLWLCNSNRLKRE