Protein Info for BWI76_RS01735 in Klebsiella michiganensis M5al

Annotation: PTS mannose/fructose/sorbose family transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR00854: PTS system, mannose/fructose/sorbose family, IIB component" amino acids 2 to 152 (151 residues), 234.2 bits, see alignment E=3e-74 PF03830: PTSIIB_sorb" amino acids 3 to 149 (147 residues), 177.9 bits, see alignment E=7.8e-57

Best Hits

Swiss-Prot: 89% identical to PTRB_KLEPN: PTS system sorbose-specific EIIB component (sorB) from Klebsiella pneumoniae

KEGG orthology group: K02813, PTS system, sorbose-specific IIB component [EC: 2.7.1.69] (inferred from 89% identity to kva:Kvar_4841)

MetaCyc: 32% identical to D-glucosaminate PTS permease components EIIB (Salmonella enterica enterica serovar Typhimurium str. 14028S)
RXN-14729 [EC: 2.7.1.203]

Predicted SEED Role

"PTS system, sorbose-specific IIB component (EC 2.7.1.69)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.203 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW66 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BWI76_RS01735 PTS mannose/fructose/sorbose family transporter subunit IIB (Klebsiella michiganensis M5al)
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDDVRRTLLRQAAPPGMKVNVV
NLEKAVAVYHNPQYQDETVFYLFTNPQDVLTMVQQGVNIATLNIGGMAWRPGKKQLTKAV
SLDEADINAFQQLDKLGVNLDLRVVASDPSVNILDKIAEQSVTE