Protein Info for BWI76_RS01690 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 46 to 69 (24 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 171 to 198 (28 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 308 (308 residues), 424.2 bits, see alignment E=3.9e-131 PF02690: Na_Pi_cotrans" amino acids 13 to 147 (135 residues), 120 bits, see alignment E=8.1e-39 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 67 to 520 (454 residues), 511 bits, see alignment E=3.2e-157

Best Hits

Swiss-Prot: 91% identical to YJBB_SALTY: Uncharacterized protein YjbB (yjbB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 95% identity to kpu:KP1_0258)

MetaCyc: 90% identical to putative inorganic phosphate export protein YjbB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-470

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW50 at UniProt or InterPro

Protein Sequence (543 amino acids)

>BWI76_RS01690 membrane protein (Klebsiella michiganensis M5al)
MLTLLHLLSAVALLVWGTHIVRTGVMRVYGARLRSVLSSSVEKKPLAFCAGIGVTALVQS
SNATTMLVTSFVAQDLVALAPALVMVLGADVGTALMARVLTFDLSWLSPLLIFIGVIFFL
GRKQTRAGQLGRVGIGLGLILLALELIVQAVHPITQANGVQVIFASLTGDIMLDALIGAV
FAIISYSSLAAVLLTATLTATGVISFPVALCLVIGANLGSGLLAMLNNSGANAAARRVAL
GSLLFKLVGSLIILPFVHLLANVMDELPLQKSELVIYFHVFYNLIRCIAMVPFAGPMANL
CKRLIRDEPELDARLKPKHLDTSALDTPALALANAARETLRIGDAMEQMLESLRKVMHGE
PREEKELRRMADDINVLYTAIKLYLARMPKEELADEESRRWAEIIEMALNLEQASDIVER
MGSEIADKSLAARRAFSMEGLKELDALYDQLLSNLQLAMSVFFSGDVPSARRLRRSKHRF
RIMNRRYSHAHVDRLHQQNVQSIETSTLHLALLGDMKRLNSLFCSVAYSVMEQPDEDDER
DDY