Protein Info for BWI76_RS01680 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator IclR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF09339: HTH_IclR" amino acids 27 to 77 (51 residues), 66.6 bits, see alignment 1.3e-22 PF01614: IclR_C" amino acids 96 to 267 (172 residues), 164.1 bits, see alignment E=2.5e-52

Best Hits

Swiss-Prot: 92% identical to ICLR_SALTY: Acetate operon repressor (iclR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13641, IclR family transcriptional regulator, acetate operon repressor (inferred from 91% identity to eum:ECUMN_4544)

Predicted SEED Role

"Acetate operon repressor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW48 at UniProt or InterPro

Protein Sequence (275 amino acids)

>BWI76_RS01680 transcriptional regulator IclR (Klebsiella michiganensis M5al)
MATPAPAKRGRKPASPAAAPAGGQVQSLTRGLKLLEWIAESHGSVALTELAQQAGLPNST
THRLLTTMQQLGFVRQVGELGHWSVGAHAFVVGSSFLQSRNLLAIVHPILRQLMEDSGET
VNLAVLDQSDHQAIIIDQVQCTQLMRMSAPIGGKLPMHASGAGKAFLSQLSEDQVTGLLH
RQGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCVASCIYDEHREPFAAIS
ISGPISRITDDRVTEFGAMVIKAAKEVTLAYGGVR