Protein Info for BWI76_RS01550 in Klebsiella michiganensis M5al

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 20 to 202 (183 residues), 194.6 bits, see alignment E=5.5e-62 PF02581: TMP-TENI" amino acids 21 to 189 (169 residues), 182.9 bits, see alignment E=1.9e-58

Best Hits

Swiss-Prot: 90% identical to THIE_KLEP7: Thiamine-phosphate synthase (thiE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 91% identity to sea:SeAg_B4406)

MetaCyc: 89% identical to thiamine phosphate synthase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW80 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BWI76_RS01550 thiamine phosphate synthase (Klebsiella michiganensis M5al)
MYQPDFPAVPFRLGLYPVVDSVAWIERLLDAGVRTIQLRIKDKRDSEVEDDVVAAIALGR
KYDARLFINDYWRLAIKHQAYGVHLGQEDLETTDLSAIRNAGLRLGVSTHDDMEIDIALA
ARPSYIALGHVFPTQTKQMPSAPQGLEQLAQHIQRLGDYPTVAIGGISLERAPAVLATGV
GSVAVVSAITQAADWRQATARLLEIAGAGDE