Protein Info for BWI76_RS01545 in Klebsiella michiganensis M5al
Annotation: thiamine biosynthesis protein ThiS
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to THIF_ECOLI: Sulfur carrier protein ThiS adenylyltransferase (thiF) from Escherichia coli (strain K12)
KEGG orthology group: K03148, adenylyltransferase [EC: 2.7.7.-] (inferred from 84% identity to kpe:KPK_5300)MetaCyc: 77% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]
Predicted SEED Role
"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
KEGG Metabolic Maps
- Biosynthesis of siderophore group nonribosomal peptides
- Lipopolysaccharide biosynthesis
- Nucleotide sugars metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.7.-
Use Curated BLAST to search for 2.7.7.- or 2.7.7.73
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AW61 at UniProt or InterPro
Protein Sequence (251 amino acids)
>BWI76_RS01545 thiamine biosynthesis protein ThiS (Klebsiella michiganensis M5al) MNDSDFMRYSRQLLLEDIAIEGQQKLLASRVLLVGLGGLGSPAALYLAGAGVGTLVLADD DDVHVSNLQRQILFTSDDISRSKAAAARARLARLNPQIELIALKQRLGGEALQDEVAKAD VVLDCTDNMATRQAINAACVALQTPLITASAVGLGGQLMVLTPPWDQGCYRCLWPDANEP ERNCRTAGIIGPVVGMMGTLQALEAIKLLAGMATPRNALRLFDARTSSWRTLALQRAQGC PVCGGQHAGVV