Protein Info for BWI76_RS01535 in Klebsiella michiganensis M5al

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF05690: ThiG" amino acids 4 to 247 (244 residues), 367.3 bits, see alignment E=3.5e-114

Best Hits

Swiss-Prot: 98% identical to THIG_KLEP3: Thiazole synthase (thiG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_08160)

MetaCyc: 90% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW32 at UniProt or InterPro

Protein Sequence (256 amino acids)

>BWI76_RS01535 thiazole synthase (Klebsiella michiganensis M5al)
MLRIADKTFESHLFTGTGKFAAPDVMVEAIRASGSQLVTLAMKRVDLRQHNDAILAPLLA
AGVSLLPNTSGAKTAEEAVFAARLAREALGTHWLKLEIHPDARWLLPDPIETLKAAEILV
REGFVVLPYCGADPVLCKRLEEAGCAAVMPLGAPIGSNQGLETKAMLEIIIEQATVPVVV
DAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVTMARAFRLAIDAGLLARQAGPGARST
QAQATSPLTGFLEARV