Protein Info for BWI76_RS01250 in Klebsiella michiganensis M5al

Annotation: threonine export protein RhtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01810: LysE" amino acids 13 to 206 (194 residues), 184.9 bits, see alignment E=6e-59 TIGR00949: homoserine/Threonine efflux protein" amino acids 18 to 203 (186 residues), 218.2 bits, see alignment E=3.7e-69

Best Hits

Swiss-Prot: 88% identical to RHTC_SALTI: Threonine efflux protein (rhtC) from Salmonella typhi

KEGG orthology group: None (inferred from 91% identity to eae:EAE_07940)

MetaCyc: 87% identical to L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-0244

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVY2 at UniProt or InterPro

Protein Sequence (207 amino acids)

>BWI76_RS01250 threonine export protein RhtC (Klebsiella michiganensis M5al)
MLTLFFTVALVHIIALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGL
NLIIAKMAWLHTIIMVGGGLYLCWMGLQMLRGALKKGEAAAAVEPQVELARSGRSFLKGL
LTNLANPKAIIYFGSVFSLFVGDSVSSGARWGIFLLIVLETLAWFTVVASLFALPGMRRG
YQRMAKWIDGIAGTLFAGFGIHLIISR