Protein Info for BWI76_RS01245 in Klebsiella michiganensis M5al

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 57 to 75 (19 residues), see Phobius details TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 13 to 601 (589 residues), 907.5 bits, see alignment E=3.6e-277 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 15 to 464 (450 residues), 675.8 bits, see alignment E=3.2e-207 PF00270: DEAD" amino acids 27 to 187 (161 residues), 91 bits, see alignment E=1.8e-29 PF00271: Helicase_C" amino acids 220 to 331 (112 residues), 80.8 bits, see alignment E=2.2e-26 PF16124: RecQ_Zn_bind" amino acids 342 to 404 (63 residues), 60.6 bits, see alignment E=4.9e-20 PF09382: RQC" amino acids 406 to 514 (109 residues), 124.8 bits, see alignment E=4e-40 PF00570: HRDC" amino acids 533 to 599 (67 residues), 84.9 bits, see alignment E=7.7e-28

Best Hits

Swiss-Prot: 92% identical to RECQ_SALTY: ATP-dependent DNA helicase RecQ (recQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_07935)

MetaCyc: 91% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVY3 at UniProt or InterPro

Protein Sequence (608 amino acids)

>BWI76_RS01245 DNA helicase RecQ (Klebsiella michiganensis M5al)
MAQAEVLNQESLAKQVLQETFGYQQFRPGQDTIIDTALAGRDCLVVMPTGGGKSLCYQVP
ALVLGGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQSREQQQEVMAGCRSGQIRLLY
IAPERLMLDNFLEHLTHWNLSMVAVDEAHCISQWGHDFRPEYAALGQLRQRIPHIPFMAL
TATADDTTRRDIVRLLDLNDPLIQVSSFDRPNIRYMLMEKFKPLDQLMRYVQDQRGKSGI
IYCNSRSKVEDTAARLQSRGISAAAYHAGLENHIRADVQEKFQRDDLQIVVATVAFGMGI
NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPAGPL
QDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGLMDARKAL
STIYRVNQRFGMGYVVEVLRGANNQRIRDMGHDKLPVYGIGREQSHEHWVSVIRQLIHLG
LVTQNIAQHSALQLTEAARPVLRGDVTLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLR
KLRKAIADEENIPPYVVFNDATLIEMAEQTPLTAGEMLSVNGVGTRKLERFGKEFMALIR
AHVDGDDE