Protein Info for BWI76_RS01120 in Klebsiella michiganensis M5al

Annotation: O-antigen translocase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF01943: Polysacc_synt" amino acids 4 to 283 (280 residues), 41.8 bits, see alignment E=4.6e-15

Best Hits

Swiss-Prot: 85% identical to WZXE_ECOLI: Lipid III flippase (wzxE) from Escherichia coli (strain K12)

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 94% identity to kva:Kvar_4936)

MetaCyc: 85% identical to lipid IIIECA flippase (Escherichia coli K-12 substr. MG1655)
7.5.99.a [EC: 7.5.99.a]

Predicted SEED Role

"WzxE protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.99.a

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AW23 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BWI76_RS01120 O-antigen translocase (Klebsiella michiganensis M5al)
MSLAKASLWTAASTLVKIGAGLLVVKLLAVSFGPAGVGQAGNFRQLVTVLGVLAGAGIFN
GVTKLVAQHHDDRRQLYNVVGTASAMVLGFSTLLALIFLLAAAPISQGLFGHQQYQNLVR
LVALVQMGIAWANFLLALMKGFRDAAGNALSLIAGSLIGVAAYYACYRFGGYQGALLGLA
LVPALVVVPAAFVLWRRGNIPLSALRPRWDNGLAGQLSKFTLMALITSVTLPVAYVMMRN
LLAAHYGWDAVGIWQGVSSISDAYLQFITASFSVYLLPTLSRLTAKADITREIGKALKFV
LPAVAAASFTVWLLRDFAIWLLFSDRFTAMRDLFAWQLVGDVLKVGAYVYGYLVIAKASL
RFYILTEISQFALLTAFSHWLIPAHGAIGAAQAYMATYIVYFALCSGVFLLWRKRA