Protein Info for BWI76_RS00875 in Klebsiella michiganensis M5al

Annotation: DNA-binding transcriptional regulator FabR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00440: TetR_N" amino acids 23 to 59 (37 residues), 33.9 bits, see alignment 1.1e-12

Best Hits

Swiss-Prot: 99% identical to FABR_KLEP7: HTH-type transcriptional repressor FabR (fabR) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 97% identity to cko:CKO_03029)

Predicted SEED Role

"Unsaturated fatty acid biosythesis repressor FabR, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVY0 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BWI76_RS00875 DNA-binding transcriptional regulator FabR (Klebsiella michiganensis M5al)
MMGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGIAPTSFYRHFRDVDELG
LTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPNAFRLLLRERSGTSAA
FRAAVAREIQHFIAELADYLEIENHMPRAFTEAQAEAMVTIVFSAGAEALDVGPEQRRQL
EERLVLQLRMISKGAYYWYRREQEKISNHSE