Protein Info for BWI76_RS00865 in Klebsiella michiganensis M5al
Annotation: DNA-binding transcriptional regulator OxyR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to OXYR_ECOL6: Hydrogen peroxide-inducible genes activator (oxyR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 95% identity to ecc:c4922)MetaCyc: 95% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AVQ4 at UniProt or InterPro
Protein Sequence (305 amino acids)
>BWI76_RS00865 DNA-binding transcriptional regulator OxyR (Klebsiella michiganensis M5al) MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQA GLLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTIGPYLLPLIIPMLHQTFPKL EMYLHEAQTHQLLAQLDSGKLDCAILALVKESEAFIEVPLFDEPMMLAIYEDHPWANREC VPMSDLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLL PALAVPQERKRDGVVYVPCIKPEPRRTVGLVYRPGSPLRSRYEHLAEAIRGKMDGHFDTA LKQAV