Protein Info for BWI76_RS00785 in Klebsiella michiganensis M5al

Annotation: cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR02080: O-succinylhomoserine (thiol)-lyase" amino acids 3 to 382 (380 residues), 694.6 bits, see alignment E=1.4e-213 PF01053: Cys_Met_Meta_PP" amino acids 6 to 380 (375 residues), 480.5 bits, see alignment E=2.9e-148 PF00155: Aminotran_1_2" amino acids 57 to 176 (120 residues), 31.3 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 96% identical to METB_ECOLI: Cystathionine gamma-synthase (metB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_07595)

MetaCyc: 96% identical to O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (Escherichia coli K-12 substr. MG1655)
4.3.1.-; Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVT9 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BWI76_RS00785 cystathionine gamma-synthase (Klebsiella michiganensis M5al)
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAILLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQNDEQALSAALAEKPKLVLVESPSNPLLRVVDIAKICGLAREAGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPATVTELAWWANNIGVTGGAFDSYL
LLRGLRTLSPRMEVAQRNALAIVDYLKTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLSGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANEE