Protein Info for BWI76_RS00745 in Klebsiella michiganensis M5al
Annotation: 1,4-dihydroxy-2-naphthoate polyprenyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 83% identical to MENA_ECOLI: 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 88% identity to eae:EAE_07555)MetaCyc: 83% identical to 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
DMK-RXN [EC: 2.5.1.74]
Predicted SEED Role
"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
- superpathway of menaquinol-10 biosynthesis (8/10 steps found)
- superpathway of menaquinol-11 biosynthesis (8/10 steps found)
- superpathway of menaquinol-12 biosynthesis (8/10 steps found)
- superpathway of menaquinol-13 biosynthesis (8/10 steps found)
- superpathway of menaquinol-6 biosynthesis (8/10 steps found)
- superpathway of menaquinol-7 biosynthesis (8/10 steps found)
- superpathway of menaquinol-9 biosynthesis (8/10 steps found)
- demethylmenaquinol-4 biosynthesis (1/1 steps found)
- demethylmenaquinol-6 biosynthesis I (1/1 steps found)
- demethylmenaquinol-8 biosynthesis I (1/1 steps found)
- demethylmenaquinol-9 biosynthesis (1/1 steps found)
- menaquinol-10 biosynthesis (1/2 steps found)
- menaquinol-11 biosynthesis (1/2 steps found)
- menaquinol-12 biosynthesis (1/2 steps found)
- menaquinol-13 biosynthesis (1/2 steps found)
- menaquinol-7 biosynthesis (1/2 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.5.1.74
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AVT8 at UniProt or InterPro
Protein Sequence (308 amino acids)
>BWI76_RS00745 1,4-dihydroxy-2-naphthoate polyprenyltransferase (Klebsiella michiganensis M5al) MTEHAITRTQAWLESLRPKTLPLAFAAIIVGSALAWHQGSFDPWVALLAIITAGLLQILS NLANDYGDAIKGSDKPDRIGPLRGMQKGAITQAQMKRALILTVALICLSGLALLFLSWQT MADFIGFMVLGGLAIVAAITYTVGTRPYGYIGLGDISVLVFFGWLSVVGSWYLQAHSVEA VIFLPATACGLLATAVLNINNLRDIDSDRENGKNTLAVRLGPVNARRYHACLLFGALLCL ALFNLISLHNPWGWLFLLATPLLVKQARYVIRERDPVAMRPMLERTVKGALLTNLLFVIG IIFSRLAA