Protein Info for BWI76_RS00690 in Klebsiella michiganensis M5al

Annotation: transcriptional activator RhaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF02311: AraC_binding" amino acids 17 to 154 (138 residues), 80.6 bits, see alignment E=1.4e-26 PF00165: HTH_AraC" amino acids 180 to 221 (42 residues), 31.4 bits, see alignment 2.4e-11 amino acids 232 to 271 (40 residues), 35.6 bits, see alignment 1.1e-12 PF12833: HTH_18" amino acids 194 to 271 (78 residues), 92 bits, see alignment E=3.5e-30

Best Hits

Swiss-Prot: 87% identical to RHAS_KLEP7: HTH-type transcriptional activator RhaS (rhaS) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02855, AraC family transcriptional regulator, L-rhamnose operon regulatory protein RhaS (inferred from 87% identity to kpu:KP1_0073)

Predicted SEED Role

"L-rhamnose operon regulatory protein RhaS" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVL5 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BWI76_RS00690 transcriptional activator RhaS (Klebsiella michiganensis M5al)
MTMLHSVDFFKSGVSAVAIEPRLPQSAFPEHHHDFHEIVIVEHGTGIHVFNGQPYTISGG
SVCFIRDHDRHLYEHTDNLCLTNVLYRAPDAFRFLSGLNALLPQEQEGNYLSHWRVNQSA
LQQVRQIVEQMEEVGADADMHAIASREILFMQLLVHLRKSSLAEGASDNEARLNHLMAWL
EDHFAEDICWEEVAARFSLSLRTLHRQLKQQTGLTPQRYLNRVRLMKARHLLRHSDDSVT
DIAYRCGFGDSNHFSTLFRREFAWSPRDIRQGRDAILQ