Protein Info for BWI76_RS00655 in Klebsiella michiganensis M5al

Annotation: inner-membrane translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 28 (2 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 37 to 305 (269 residues), 127.7 bits, see alignment E=2.4e-41

Best Hits

Swiss-Prot: 34% identical to LSRC_KLEP7: Autoinducer 2 import system permease protein LsrC (lsrC) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K10560, rhamnose transport system permease protein (inferred from 96% identity to kpe:KPK_5473)

MetaCyc: 35% identical to Autoinducer-2 ABC transporter membrane subunit LsrC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 2" in subsystem L-rhamnose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVT5 at UniProt or InterPro

Protein Sequence (334 amino acids)

>BWI76_RS00655 inner-membrane translocator (Klebsiella michiganensis M5al)
MWRQLLKHREALLAAVIILMIGAIGSRAPSFVSPGNLVEMFNDTAILIILALGQMMVLLT
KGIDLSMAANLALTGMIVALLNAHYPGIPVAALLALATLLGLLMGMINGLLVWRLGIPAI
VVTLGTMSIYRGIIFLLSDGGWVNSHQMSADFLGLPRASLLGLPLLSWCAIAALLLVGYF
LRYSRTGRALYTAGGNATAAYYTGINAGKMQFVSFCLSGALAGFCGYLWISRFAVAYVDV
ANGFELQVVAACVIGGISTMGGTGRVLGCLCGALFLGVINNALPVIGISPFWQMAISGAV
IVIAVLLNERSNKTHGRLILRNAALARQKQAVKS