Protein Info for BWI76_RS00610 in Klebsiella michiganensis M5al
Annotation: MFS transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to MELY_ENTCC: Melibiose permease (melY) from Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56)
KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 96% identity to kpu:KP1_0063)MetaCyc: 60% identical to lactose permease (Escherichia coli K-12 substr. MG1655)
RXN-17755; RXN0-7215; RXN0-7217; TRANS-RXN-24; TRANS-RXN-94
Predicted SEED Role
"Lactose permease" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Lactose and Galactose Uptake and Utilization or Lactose utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285AVL8 at UniProt or InterPro
Protein Sequence (421 amino acids)
>BWI76_RS00610 MFS transporter (Klebsiella michiganensis M5al) MNPTVCTHKNNPNFWIFGLFFFLYFFIMATCFPFLPIWLSDVIGLNKTETGIVFSSLSLF AICFQPILGVISDKLGLKKHLMWIVTVLLVLIAPFFLYVFAPLLKTNIWLGALSGGAYIG FVFSAGAGAMEAYIERVSRNSGFEYGKARTFGCLGWALCATTAGMLFSVNPEWVFWMGSA AALVLVVLVAIAKPQASQTAQVMDSLGANRSSVDLKTAVRMFRQRKMWMFILYVIGVACV YDVFDQQFATFFKSFFATPESGTRAFGFATTAGEICNAIIMFSSPWIINRIGAKNTLLIA GMVMAARMIGSSFATTAAEVVALKMLHALEVPFLLVGAFKYITGVFDVRLSATIYLVGFQ FSKQVAAIFLSAFAGNMYDRIGFQDTYMILGGIALTVTLISAFTLSGKATSEKMRDNAMT V