Protein Info for BWI76_RS00540 in Klebsiella michiganensis M5al

Annotation: PTS system ascorbate-specific transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 312 to 361 (50 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details PF03611: EIIC-GAT" amino acids 12 to 406 (395 residues), 403.8 bits, see alignment E=4.4e-125

Best Hits

KEGG orthology group: K03475, PTS system, ascorbate-specific IIC component (inferred from 98% identity to kpn:KPN_04195)

Predicted SEED Role

"FIG00732228: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVJ5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>BWI76_RS00540 PTS system ascorbate-specific transporter subunit IIC (Klebsiella michiganensis M5al)
MNSFVEFIVKDLLGQASILIAFIAMLGLILQKKSAGKTAEGTFKTLLGFLIMMAGINIIV
ATLTFLNDIFTQGFGMKGYITDVAAIAGLANRELGSEVALTLMVIFAVNIIIARLTPLKY
IFLTGQALLWMATIGAVIGYKAGLTGLPLILTGGIFGGVMAVLMPALAQPVVRRITGSDD
VALGHFCTIGYLVQAAVAKVVGKGSRSTEDLELPDNFKFLQDTYLAMAVVMVPMYLIPAV
AAGPEYIAQFSNGINYLMYAFMQSIQFVAGVFVLYSGVRLLLNELVSAFRGIAMRIVPDA
KPALDCPVLFPYAPNAVIVGFLATTVGSIIGMLVFPMFGLAMILPGLLTNFFAGGTAGVF
GNALGGRRGAMIGGVIHGLFITFLPAILVPMLESYGFTGVTFSDSDVISSGLVLGHAFQN
NWLFVALFIVFVAALAWFVNGKSAKPKGENVHESV