Protein Info for BWI76_RS00475 in Klebsiella michiganensis M5al

Annotation: sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 34 to 276 (243 residues), 311.9 bits, see alignment E=1.3e-97 PF02634: FdhD-NarQ" amino acids 38 to 275 (238 residues), 236.2 bits, see alignment E=2.3e-74

Best Hits

Swiss-Prot: 90% identical to FDHD_KLEP3: Sulfur carrier protein FdhD (fdhD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02379, FdhD protein (inferred from 90% identity to kva:Kvar_5031)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVL9 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BWI76_RS00475 sulfurtransferase FdhD (Klebsiella michiganensis M5al)
MNKKPLEQIENVTDITGYRQVSLWKRQNLQHPQPDELAEEVPVALVYNGISHVVMMATPK
DLAQFAVGFSLSEGIIENRGEIYGMDVLQACNGLEVQIELSSRRFMGLKERRRALAGRTG
CGVCGVEQLNDIGKPVQPLPFTQTFDLANLDRALAHLHDFQPIGRLTGCTHAAAWVRPSG
DLAGGHEDVGRHVALDKLLGHRAESEGAWQNGAALVSSRASYEMVQKAAMCGVEILFAVS
AATTLAVDVAERCNLTLVGFCKPGRATVYTHPQRLIAG