Protein Info for BWI76_RS00385 in Klebsiella michiganensis M5al

Annotation: nitrogen assimilation regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 466 (460 residues), 810 bits, see alignment E=3e-248 PF00072: Response_reg" amino acids 8 to 115 (108 residues), 109.2 bits, see alignment E=3.7e-35 PF00158: Sigma54_activat" amino acids 140 to 306 (167 residues), 240.2 bits, see alignment E=3e-75 PF14532: Sigma54_activ_2" amino acids 141 to 311 (171 residues), 76.4 bits, see alignment E=8.2e-25 PF07724: AAA_2" amino acids 160 to 279 (120 residues), 27.3 bits, see alignment E=1.1e-09 PF07728: AAA_5" amino acids 164 to 283 (120 residues), 34.7 bits, see alignment E=5.2e-12 PF02954: HTH_8" amino acids 427 to 466 (40 residues), 51.5 bits, see alignment 2e-17

Best Hits

Swiss-Prot: 100% identical to NTRC_KLEPN: DNA-binding transcriptional regulator NtrC (ntrC) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 98% identity to eae:EAE_07340)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVF7 at UniProt or InterPro

Protein Sequence (469 amino acids)

>BWI76_RS00385 nitrogen assimilation regulatory protein (Klebsiella michiganensis M5al)
MQRGIAWIVDDDSSIRWVLERALTGAGLSCTTFESGNEVLDALTTKTPDVLLSDIRMPGM
DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVDRAIS
HYQEQQQPRNAPINSPTADIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHA
LHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTVRQGRFEQADGGTLFLDE
IGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLELRVQEGKFREDLFHR
LNVIRVHLPPLRERREDIPRLARHFLQIAARELGVEAKQLHPETEMALTRLAWPGNVRQL
ENTCRWLTVMAAGQEVLTQDLPSELFETAIPDNPTQMLPDSWATLLGQWADRALRSGHQN
LLSEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME