Protein Info for BWI76_RS00330 in Klebsiella michiganensis M5al

Annotation: molybdenum cofactor guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR02665: molybdenum cofactor guanylyltransferase" amino acids 6 to 187 (182 residues), 222 bits, see alignment E=3.3e-70 PF12804: NTP_transf_3" amino acids 8 to 157 (150 residues), 117.1 bits, see alignment E=4.5e-38

Best Hits

Swiss-Prot: 67% identical to MOBA_SALTY: Molybdenum cofactor guanylyltransferase (mobA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 74% identity to eae:EAE_07290)

MetaCyc: 66% identical to molybdenum cofactor guanylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-21601 [EC: 2.7.7.77]; 2.7.7.77 [EC: 2.7.7.77]

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVF0 at UniProt or InterPro

Protein Sequence (193 amino acids)

>BWI76_RS00330 molybdenum cofactor guanylyltransferase (Klebsiella michiganensis M5al)
MQGKVITGVVLAGGRGTRMGGIDKGLQLLKGKALWRHVADRLQPQVTKLVISANRNLDCW
RSSGYPIITDSLNDFPGPLAGMLSVMHQVEGEWFLFCPCDTPFIPLFLAERLILQKKSSP
VVWVHDGERDHPAIALVNRVVISELETYLAAGERRVMVFMRKMGGHSVDFSDVKSAFINV
NTLSDLQSMEVSS