Protein Info for BWI76_RS00325 in Klebsiella michiganensis M5al

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein MobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF03205: MobB" amino acids 5 to 139 (135 residues), 156.7 bits, see alignment E=1.6e-50 TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B" amino acids 5 to 164 (160 residues), 163.1 bits, see alignment E=2.5e-52

Best Hits

Swiss-Prot: 72% identical to MOBB_ECOLI: Molybdopterin-guanine dinucleotide biosynthesis adapter protein (mobB) from Escherichia coli (strain K12)

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 83% identity to kpu:KP1_0016)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVK7 at UniProt or InterPro

Protein Sequence (168 amino acids)

>BWI76_RS00325 molybdopterin-guanine dinucleotide biosynthesis protein MobB (Klebsiella michiganensis M5al)
MIPLLAIAAWSGTGKTTLLKALIPALRAEGIRPGLIKHTHHDMDVDKPGKDSYELRKAGA
AQTIVASSQRWALITETPEEPPLDLTWLASRMDASTLDLVLVEGFKHEAVPKILLFRQNS
GHCREELVFDDDVIAVASDTPVETSLPLLDLNNIPQIAVFIMQWLKRA