Protein Info for BWI76_RS00295 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator RbsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00356: LacI" amino acids 1 to 45 (45 residues), 64.3 bits, see alignment 1.4e-21 PF00532: Peripla_BP_1" amino acids 57 to 316 (260 residues), 110.1 bits, see alignment E=3e-35 PF13407: Peripla_BP_4" amino acids 59 to 302 (244 residues), 59.1 bits, see alignment E=1.1e-19 PF13377: Peripla_BP_3" amino acids 167 to 326 (160 residues), 139.6 bits, see alignment E=2.1e-44

Best Hits

Swiss-Prot: 85% identical to RBSR_SHIFL: Ribose operon repressor (rbsR) from Shigella flexneri

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 94% identity to kpn:KPN_04158)

MetaCyc: 46% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVG7 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BWI76_RS00295 transcriptional regulator RbsR (Klebsiella michiganensis M5al)
MKDVARIAGVSTSTVSHVINKDRFVSEAITAKVDAAIKSLNYAPSALARSLKLNQTRTIG
MLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMNRNLETLMQKRVDGLLLLC
TETHQPSPEIMQRYPSVPTVMMDWAPFDGDSDLIQDNSLLGGDMATKYLIDQGYTRIACI
AGPLDKTPARLRLEGYQAAMARAGLTVPEGYVISSDFEFGGGFSAMQKLLTLSALPQAVF
IGNDAMAVGAYQALYQGGLRIPQDMALVGYDDIELARYMTPPLTTIHQPKDELGELAIDV
LIHRMADPGQKQQRVQLTPELVVRGSA