Protein Info for BWI76_RS00010 in Klebsiella michiganensis M5al

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF13514: AAA_27" amino acids 1 to 87 (87 residues), 26.5 bits, see alignment E=1.2e-09 PF13175: AAA_15" amino acids 1 to 46 (46 residues), 41.7 bits, see alignment 2.9e-14 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 355 (355 residues), 454.1 bits, see alignment E=1.9e-140 PF02463: SMC_N" amino acids 3 to 354 (352 residues), 167.3 bits, see alignment E=9e-53 PF13476: AAA_23" amino acids 5 to 51 (47 residues), 38.7 bits, see alignment 4.2e-13 PF13304: AAA_21" amino acids 25 to 47 (23 residues), 27.7 bits, see alignment (E = 6.7e-10)

Best Hits

Swiss-Prot: 96% identical to RECF_KLEP3: DNA replication and repair protein RecF (recF) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 94% identity to cko:CKO_00046)

MetaCyc: 93% identical to recombination mediator protein RecF (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AV99 at UniProt or InterPro

Protein Sequence (357 amino acids)

>BWI76_RS00010 DNA replication and repair protein RecF (Klebsiella michiganensis M5al)
MSLSRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQIGRV
IRHEQESFVLHGRLQGEEREVSIGLTKDKQGDSKVRIDGTDGHKVAELAHLMPMQLITPE
GFTLLNGGPKYRRAFLDWGCFHNEAGFFTAWSNLKRLVKQRNAALRQVSRYAQLRPWDLE
LIPLAELISRWRAEYSAAIVEDMADTCRQFLPEFALTFSFQRGWEKETDYAEVLERNFER
DRMLTYTAHGPHKADFRIRADGAPVEDTLSRGQLKLLMCALRLAQGEFLTRESGRRCLYL
IDDFASELDDARRGLLASRLKATQSQVFVSAISAEHVMDMSDENSKMFTVEKGKIAD