Protein Info for BPHYT_RS35575 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF07883: Cupin_2" amino acids 46 to 117 (72 residues), 67 bits, see alignment E=9.7e-23 PF05899: Cupin_3" amino acids 57 to 98 (42 residues), 33.1 bits, see alignment E=3.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7188)

Predicted SEED Role

"Putative auxin-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAH1 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BPHYT_RS35575 transcriptional regulator (Burkholderia phytofirmans PsJN)
MPKVDTAAVPARNGSGYPPPFDAPCAARTRKRLGEAGGLRDFGVNLMTLPPGSWSSQRHW
HSHEDEFVYVLEGEVTLIEDDGETLLRAGDCAAFAQGTGNGHHLINHSSAMAVYLEVGSR
NPHDLTTCSDIDMMSANADGQFVHKDGTLYPV