Protein Info for BPHYT_RS35535 in Burkholderia phytofirmans PsJN

Annotation: arsenic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 16 to 342 (327 residues), 381.1 bits, see alignment E=2.5e-118 PF01758: SBF" amino acids 62 to 255 (194 residues), 104.4 bits, see alignment E=6.4e-34

Best Hits

Swiss-Prot: 52% identical to ACR3_ALKMQ: Arsenical-resistance protein Acr3 (acr3) from Alkaliphilus metalliredigens (strain QYMF)

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 100% identity to bpy:Bphyt_7179)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAG3 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BPHYT_RS35535 arsenic transporter (Burkholderia phytofirmans PsJN)
MTSTVKTIRGAPSAIGFFERYLTVWVALCIVCGVALGQWLPLPFQAIGRMEVAQVNLPVG
MLIWVMIIPMLIKIDFTAMTQVKSQWRGIGVTLFVNWLVKPFSMALLGWIFIRHVFAPWL
PAAQLDSYIAGLILLAAAPCTAMVFVWSQLCKGDPYFTLSQVALNDSIMIVAFAPLVALL
LGLSAITVPWDTLITSVGLYIVVPVILAQLLRRRLLTRGDAYFQQVVAHLGPYSIGALLA
TLVLLFAFQGQAIVDEPLVIAMLAVPILIQVFFNSGLAYLLNRRLGVAHCVAGPSSLIGA
SNFFELAVATAISLFGFHSGAALATVVGVLIEVPVMLLVVGVVNRSQHWYETKHSVKGQR
V