Protein Info for BPHYT_RS35530 in Burkholderia phytofirmans PsJN

Annotation: arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00014: arsenate reductase (glutaredoxin)" amino acids 3 to 115 (113 residues), 147 bits, see alignment E=1.6e-47 PF03960: ArsC" amino acids 6 to 113 (108 residues), 74.7 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 63% identical to ARSC2_ECOLX: Arsenate reductase (arsC) from Escherichia coli

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 100% identity to bpy:Bphyt_7178)

MetaCyc: 70% identical to arsenate reductase (glutathione/glutaredoxin) (Sinorhizobium meliloti)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAG2 at UniProt or InterPro

Protein Sequence (140 amino acids)

>BPHYT_RS35530 arsenate reductase (Burkholderia phytofirmans PsJN)
MSVTIYHNPDCGTSRNTLAMIRNAGIEPEIIEYLKSPPDRDTLKNLIERAGLTVRDVLRE
KGTPYDELGLADLSLSDEQLLDAMLTHPILVNRPIVVTPLGVRLCRPSEIVLDILPAGQQ
RAFAKEDGEQVIDSAGRRVR