Protein Info for BPHYT_RS35425 in Burkholderia phytofirmans PsJN

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF00165: HTH_AraC" amino acids 11 to 51 (41 residues), 29.2 bits, see alignment 1.6e-10 PF12833: HTH_18" amino acids 29 to 103 (75 residues), 67.2 bits, see alignment E=2.6e-22 PF06445: GyrI-like" amino acids 127 to 276 (150 residues), 94.3 bits, see alignment E=1.9e-30 PF14526: Cass2" amino acids 138 to 274 (137 residues), 72.9 bits, see alignment E=7.1e-24

Best Hits

KEGG orthology group: K13653, AraC family transcriptional regulator (inferred from 100% identity to bpy:Bphyt_7157)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAE1 at UniProt or InterPro

Protein Sequence (277 amino acids)

>BPHYT_RS35425 AraC family transcriptional regulator (Burkholderia phytofirmans PsJN)
MNPVGKALWFIESHFAHELTLDDIAGCGCVSRFHLARAFEAATGFSVMRYVRGRRLSEAA
RRLASGAPDILAVAIEAGYGSHEAFTRAFREQFGFTPDALRARGHLDTLALVEPIKMDET
LLTHLEPPRFEDGKALLVAGLSERYTSETCAAIPSQWQRFGDYFGKVPGQVGNVAYGVCY
NADDSGNIDYLCGVEVSDFSALPAELSRLRISPQRYAVFSHREHVSTIRRTWNTIWNQWL
PTSGHIPADAPNFERYDEKFDPVSGMGGLEIWLPLKG