Protein Info for BPHYT_RS35180 in Burkholderia phytofirmans PsJN

Annotation: high potential iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01355: HIPIP" amino acids 36 to 100 (65 residues), 94.2 bits, see alignment E=2.3e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7106)

Predicted SEED Role

"Hydrogenase maturation factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA92 at UniProt or InterPro

Protein Sequence (103 amino acids)

>BPHYT_RS35180 high potential iron-sulfur protein (Burkholderia phytofirmans PsJN)
MKTSRRHFLLLGVSAGSAFVLTRAAFADTANTLSESDPKAQAVGYKEDASKVDKAKFPGY
AAGQSCANCSLFQGKASDAYGGCTLFGDKQVAARGWCSSYSNM