Protein Info for BPHYT_RS35010 in Burkholderia phytofirmans PsJN

Annotation: 2-alkenal reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF00012: HSP70" amino acids 4 to 76 (73 residues), 54.1 bits, see alignment E=8.8e-19 amino acids 81 to 513 (433 residues), 397.9 bits, see alignment E=6.6e-123 PF06723: MreB_Mbl" amino acids 101 to 341 (241 residues), 36.3 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K04045, molecular chaperone HscC (inferred from 100% identity to bpy:Bphyt_7074)

Predicted SEED Role

"Chaperone protein hscC (Hsc62)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA60 at UniProt or InterPro

Protein Sequence (569 amino acids)

>BPHYT_RS35010 2-alkenal reductase (Burkholderia phytofirmans PsJN)
MPSIIGIDLGTTHSLAAIWRDDRAVLIPNALGETLTPSCVSIDGDGSILVGRPAHDRLHT
HPERTAANFKRYMGTSRAVSLGTQTLRPEELSSLVLKSLKADAEAFLGATVSDAVIAVPA
YFSDAQRKATRIAGELAGLNVLRLVNEPTAASLAYGVHQRDSERKFLIFDLGGGTFDVSV
LDFFEGVMEVRASTGDNFLGGEDFTDALVELFCQRNGLKLQSLTPVAAQRLHQQAERAKR
QLTQNGIDSVTLELTIDDNQHVLELDAAAAERTCEHLLQRLRKPVERALRDSKIAVAALD
EIILVGGASRMPMVRKLVSKMFGRLPAGHLNPDEVVALGAAVQAGLVGRDAGLDEMVLTD
VAPYSLGIDTAMQVGPAQFVPGHFLPIIERNTIVPVSRMQRIFTVRDRQQMLSIKVFQGE
ARLTTDNVALGEFTLEVPLKAAGDAGADVRFTYDINGVLEVEATAFPGGVKRAMVIEENP
GVMTAEEIRQRLAALSALKIHPRDQLENRTLMTRADRVYEETLGDHRQYLAAHIARFQAL
IERQDADEIARARGELSALLDRFDVHVSY