Protein Info for BPHYT_RS35005 in Burkholderia phytofirmans PsJN

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 284 to 303 (20 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details amino acids 468 to 489 (22 residues), see Phobius details amino acids 496 to 514 (19 residues), see Phobius details amino acids 534 to 560 (27 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_7073)

Predicted SEED Role

"DnaJ-class molecular chaperone"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TA59 at UniProt or InterPro

Protein Sequence (569 amino acids)

>BPHYT_RS35005 molecular chaperone DnaJ (Burkholderia phytofirmans PsJN)
MNTISNNHWPWDVLGIESDADERAVRRAYARLLKQRRPDEDAEAFQRLRYAYESALQMAS
GAVAKDMDAASAANVSDAEPAVLVETAQESDIAPATSRATLDTAQSQAATREADPFETAV
QLWHDFIAQADDLESRRSLQDLFAAVVNLATRDELEWQALCHCLNEDTPATLRMNLSAVL
GWRDNSTHLRRRNAAIATLALNRVFADEDYDALRLRFTNAMALLEGPLPQMTAGARALLR
AGVRAEMEQLLTALGRYHPNVVRLRLDAEKVDFWGRCLKFRVGAGRLFGPALALNAWCGL
LFADASLNPNSNRWFDQWSPAQLGIFLSTLMLALTTVAATTVLLSELQQQRLRALRSIGW
LRYGWITVWLGATAFALCDDSSGRSTSIAMATLGVCTIWAALIHGWPPVKELAILAAFSA
TALGFAGHWIATDSHAWLMPYAHGVLFAFFFSFSQAEWRGWIARRPRLFWACVPLWWAGF
VALIVLLLQQEVRTTQFAWALFAVMSAAGGVLATTRWNDLRNAIPAFFRGYANLVWMALA
IYKPDIIACVSAGLMSIWVIEGIKQRPAT