Protein Info for BPHYT_RS34810 in Burkholderia phytofirmans PsJN

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 871 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details amino acids 717 to 736 (20 residues), see Phobius details amino acids 747 to 767 (21 residues), see Phobius details amino acids 773 to 794 (22 residues), see Phobius details amino acids 806 to 826 (21 residues), see Phobius details amino acids 838 to 858 (21 residues), see Phobius details TIGR03480: hopanoid biosynthesis associated RND transporter like protein HpnN" amino acids 6 to 863 (858 residues), 1068.9 bits, see alignment E=0 PF03176: MMPL" amino acids 62 to 426 (365 residues), 70.7 bits, see alignment E=5.5e-24 amino acids 613 to 858 (246 residues), 28.9 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to bpy:Bphyt_7033)

Predicted SEED Role

"Hopanoid-associated RND transporter, HpnN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T805 at UniProt or InterPro

Protein Sequence (871 amino acids)

>BPHYT_RS34810 RND transporter (Burkholderia phytofirmans PsJN)
MLKSSIVRLVAYSVRHPLKVVALSLVLAVLSGFYVAYNFKINTDISRLIENDKQWSALEH
AVDEAFPDRGQTVLVVVEARAPEFADAAAQALTTALKADPKEFVAVSQPAGGPFFEHNGL
LFPSLDEVMSTTSQLVQSRPLVNALAHDPSLTGLAGTLTTSLLLPLQLGQVKLGDMSHLL
SQSASTLDRVLAGQPAAFSWRALVDKSAAAEPARAFVIVQPVVNYDALEPGASASKSIRD
TAAALHLESRYGAIVRLTGEQPLADEEFASVKDGAALNGIGTFIVVLIILWLALRSGRMI
AAVFITLFVGLAITAALGLMLVGALNMISVAFMVLFVGLGVDFGVQFGVKYREERNRDNR
LSAALMHTSHSIGVPLTLAAIAVALSFFSFLPTAYRGVSELGEIAGVGMFVAYFTNMTLL
PALLKIFRPPGEAGSPGFKQLAPVDDFLDHHRKPVLIGTLIVVIGASPLLTHLRFDFNPL
HLKDPHTESMETLLSLKDSPEAAVNNVHVLAPSLADADRMAAHLRTLPEVGRVNTLDTFV
PADQQQKLMLIASAAQQLLPALQQQPAQQATDAIRVAALKRASNQLSLAADDHPGPGAAE
AKHLSATLQKLAATDAATRDRAETAMSETLRIALKQLANLLQPTEITYENLPKEISKAWV
SKDGRALVDISPKVKPGTDPNDDVMLAHFAHAVKKAEPGAIGGPISILHSADTIIKAFLQ
AAGYALVSIAILLWIALRRVGDMLRTLVPLLVSALVTLELCVVFGMPLNFANIIALPLML
GVGVAFKIYFVMAWRHGQTGLLQSSLTHAVLFSAATTATAFGSLWLSHHPGTSSMGRLLA
LSLFCTLIGAVVFQPVLMGKPRSRRAKQKGI