Protein Info for BPHYT_RS34315 in Burkholderia phytofirmans PsJN

Annotation: aldehyde-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03126: formaldehyde-activating enzyme
  • amino acids 10 to 167 (158 residues), 140 bits, E=3.6e-45
• PF08714: Fae
  • amino acids 11 to 168 (158 residues), 164.3 bits, E=1.2e-52

Best Hits

Swiss-Prot: 37% identical to FAE_METBF: 5,6,7,8-tetrahydromethanopterin hydro-lyase (faeA) from Methanosarcina barkeri (strain Fusaro / DSM 804)

KEGG orthology group: K10713, formaldehyde-activating enzyme [EC: 4.3.-.-] (inferred from 100% identity to bpy:Bphyt_6933)

Predicted SEED Role

"FIG00456375: hypothetical protein"

KEGG Metabolic Maps

• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.-.-

Sequence Analysis Tools

See B2T9X3 at UniProt or InterPro

Protein Sequence (174 amino acids)

>BPHYT_RS34315 aldehyde-activating protein (Burkholderia phytofirmans PsJN)
MSASTDKQLFIGEGFEGPGVNLAHINVLVGPRNGPAGQAFATALATPSAGHAPFVVIARP
GVPTKPLTLYVNKAQIGSDFHGNATWGASQAGIAKAVAESLENGTLPPEAENDWVVVSAN
WVNPSTDDLDAVFENNYRACKSAIVAAMKGLPHRDEVFAAARDVSNPFYTPKQR