Protein Info for BPHYT_RS34215 in Burkholderia phytofirmans PsJN

Updated annotation (from data): 2-keto-3-deoxy-L-fuconate 4-dehydrogenase FucDH
Rationale: Specifically important for L-fucose utilization; this is part of the oxidative pathway.
Original annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 183 (176 residues), 159.3 bits, see alignment E=1.7e-50 PF08659: KR" amino acids 11 to 153 (143 residues), 25.5 bits, see alignment E=2.4e-09 PF13561: adh_short_C2" amino acids 15 to 246 (232 residues), 197.1 bits, see alignment E=7.2e-62 PF01370: Epimerase" amino acids 19 to 166 (148 residues), 23.5 bits, see alignment E=6.8e-09

Best Hits

Swiss-Prot: 59% identical to FUCDH_XANCP: 2-keto-3-deoxy-L-fuconate dehydrogenase (XCC4067) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6913)

MetaCyc: 70% identical to 2-dehydro-3-deoxy-D-pentonate/2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Herbaspirillum huttiense)
RXN-22641 [EC: 1.1.1.434]; 1.1.1.434 [EC: 1.1.1.434]

Predicted SEED Role

"2-keto-3-deoxy-L-fuconate dehydrogenase" in subsystem L-fucose utilization temp

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9V3 at UniProt or InterPro

Protein Sequence (247 amino acids)

>BPHYT_RS34215 2-keto-3-deoxy-L-fuconate 4-dehydrogenase FucDH (Burkholderia phytofirmans PsJN)
MTQRLAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDGLAGKPVEARKLDVRDDA
AIKALAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFLPAMLDK
GGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICPGTVASP
SLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFTTGHAHV
IDGGWSN