Protein Info for BPHYT_RS33650 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 144 to 171 (28 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 68% identical to Y3999_BURTA: Probable inner membrane protein BTH_II0599 (BTH_II0599) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6796)

Predicted SEED Role

"FIGfam005179"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9I8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>BPHYT_RS33650 membrane protein (Burkholderia phytofirmans PsJN)
MQLIEVPAKAGYVWFRQGIWLFRKNPLAFLTLFFTYLLVMTLVAQIPVVGGVLPLAFIPG
VAVGFMAACRNTIAGKPVFPTILVDGFHSYGPVVAKRLLVLGVLYVVAMALVLAASALAD
GGMLLKVMLGAATMDQDAIANSNIPLAVITAFVVYIPVAMIFWFSPILAAWHDVPPVKAM
FFSLVSCWRNRGAFIVFGALWFAVAMTVSLGLSALMQALGAGDFAFAILMPATMIVTTML
YCSFYATYRGCFGVQTPEAPDLPTTPAA