Protein Info for BPHYT_RS33605 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 383 to 407 (25 residues), see Phobius details amino acids 418 to 433 (16 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 3 to 353 (351 residues), 156.2 bits, see alignment E=1.3e-49 PF00070: Pyr_redox" amino acids 186 to 267 (82 residues), 27.7 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 100% identity to bpy:Bphyt_6787)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9I3 at UniProt or InterPro

Protein Sequence (449 amino acids)

>BPHYT_RS33605 FAD-dependent pyridine nucleotide-disulfide oxidoreductase (Burkholderia phytofirmans PsJN)
MHRFIVVGGGAGGLELATRLGDRYAPHKNKGGVQAQVTLVDRNPTHIWKPLLHEVAAGSM
DPFTQELEYAAQARWHGFEFQQGDLTGLDRANKRLTLGTVLDDDGAELLPERQLEYDTLI
IAIGSTTAFFGVKGAPEFSLALDTVSQAERFRKRLIAACMRAEHQVHEPVEAAPAVGAPG
EPRIQVAIVGGGATGVELSAELRNTAQVLSAYGLHKLDPRHDVGIVLIEAGPRILPALQE
RVSTATAELLTKLGVKLMIGETVAEVAPGMIRTASGKTVRADLTVWAAGIKAPAILSELD
GLPVNRLGQLIVRRTLQTETDDNVFALGDCAACPWPGNERNVPPRAQAAHQQASFLMKAL
AARLENKPLPEFTYRDFGSLVSLGHFSAVGNLMGGVIGGNMLIEGLFARFMYMSLYRLHI
AALHGYARMVLDTFAHWLRRTTLPRVKLH