Protein Info for BPHYT_RS33585 in Burkholderia phytofirmans PsJN

Annotation: exodeoxyribonuclease VII small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01280: exodeoxyribonuclease VII, small subunit
  • amino acids 25 to 79 (55 residues), 72.4 bits, E=1.2e-24
• PF02609: Exonuc_VII_S
  • amino acids 26 to 76 (51 residues), 71.1 bits, E=3.2e-24

Best Hits

Swiss-Prot: 72% identical to EX7S_BURL3: Exodeoxyribonuclease 7 small subunit (xseB) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 99% identity to bxe:Bxe_B2829)

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

See B2T9H5 at UniProt or InterPro

Protein Sequence (102 amino acids)

>BPHYT_RS33585 exodeoxyribonuclease VII small subunit (Burkholderia phytofirmans PsJN)
MAKTASKDTAATPAEGVDSTPLPENYEAAQAELEGLVARMESGNLSLEESLTAYRRGAAL
VAFCQQQLEKVEQQVRVLDGETLKPLPMNTAGTAATESGDDL