Protein Info for BPHYT_RS33565 in Burkholderia phytofirmans PsJN

Annotation: tRNA threonylcarbamoyladenosine modification protein TsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 3 to 316 (314 residues), 429.9 bits, see alignment E=5.3e-133 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 309 (306 residues), 373.7 bits, see alignment E=6.9e-116 PF00814: TsaD" amino acids 24 to 309 (286 residues), 314.2 bits, see alignment E=4.7e-98

Best Hits

Swiss-Prot: 98% identical to TSAD_PARXL: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 100% identity to bpy:Bphyt_6779)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9H1 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BPHYT_RS33565 tRNA threonylcarbamoyladenosine modification protein TsaD (Burkholderia phytofirmans PsJN)
MLVLGIESSCDETGLALYDTERGLLAHALHSQIAMHREYGGVVPELASRDHIRRALPLLE
EVMERAGAARGDIDAIAYTQGPGLAGALLVGASVANSLAMAWDKPTIGIHHLEGHLLSPL
LVDEPPPFPFVALLVSGGHTQLMRVTDVGVYETLGETLDDAAGEAFDKTAKLLGLGYPGG
PEVSRMAEFGTPGAVVLPRPMLHSGDLDFSFSGLKTAVLTHAKKLGGANICEQAKADLAR
GFVDAAVDVLAAKSLAALKKTELNRLVVAGGVGANRQLREALSAAAKKRNFYVHYPDLSL
CTDNGAMIALAGALRLQRWPDQSGKDYAFTVRPRWDLTSLAR