Protein Info for BPHYT_RS33465 in Burkholderia phytofirmans PsJN

Annotation: D-alanyl-D-alanine carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details PF00768: Peptidase_S11" amino acids 165 to 389 (225 residues), 171.4 bits, see alignment E=3.4e-54 PF13354: Beta-lactamase2" amino acids 170 to 319 (150 residues), 36.8 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 100% identity to bpy:Bphyt_6762)

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-, 3.4.99.-

Use Curated BLAST to search for 3.4.21.- or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9F4 at UniProt or InterPro

Protein Sequence (410 amino acids)

>BPHYT_RS33465 D-alanyl-D-alanine carboxypeptidase (Burkholderia phytofirmans PsJN)
MPYGHRTPSSEFPAFRFPAWLRCLAVFGLLWLNIGWSFGAAHEPARQPSARASQHVEPST
RRTSKAKAQRSNKAKKPTAGKTRRRFAHKRKHVASPERTMHVSKVTPKHRRQAARNARDT
RGVRRPAALAAKGNPQRASASRAAMSHKGPRLLARCGYTPKSRALLRARSVYVVDERTQT
VLAEKQADRVMPIASVSKLMTAVVALDAKHALNAPLNVTVQDQDFDKFTGSRLSVGSTLS
RHDMLHIALMSSENRAAAALSRDYTGGRPGFVAAMNAKARLLGMRHTSFVNGTGLSAQNV
STARDLSLLVAAASRYPLIRAYSTDRDQVVLPGGGRASLSYHNSNALVRGGDRSIVLQKT
GFINEAGHCVVVRMKVHGRPVDIVVLGAPGAHDHIADVARISRWLHCSLR