Protein Info for BPHYT_RS33330 in Burkholderia phytofirmans PsJN

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 42 to 68 (27 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 314 to 342 (29 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details signal peptide" amino acids 25 to 25 (1 residues), see Phobius details PF00375: SDF" amino acids 5 to 404 (400 residues), 370.7 bits, see alignment E=4.6e-115

Best Hits

Swiss-Prot: 40% identical to GLTP_BACSU: Proton/glutamate-aspartate symporter (gltP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6735)

Predicted SEED Role

"FIG00464892: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9C7 at UniProt or InterPro

Protein Sequence (435 amino acids)

>BPHYT_RS33330 C4-dicarboxylate ABC transporter (Burkholderia phytofirmans PsJN)
MKNRLTFYIVAGMALGVIVGYVCHRSAAGAAEAKTIAGYFSIITDIFLRLVKMIIAPLVF
ATLVSGLAGMEGTSDVRRIGFRSVGWFVCASLFSLALGLALANALQPGAGLHMTQTSSDV
ATGLNTAGLNFKDFVTHAFPSSIIDAMARNDILQILVFSVLFGVVLSAIKKDPRVTPLIA
GIDALVPAMLKLTDYVMRLAPIGVFGALASAITVNGLDVLTTYGKLVGSFYLGLVTLWIV
LIFVGYAFLGKSIWRLLKAVREPAMLAFSTASSEAAYPRLTEKLEAFGIDKKVVGFTLPL
GYAFNLDGSMMYQAFAAIFIAQAFGIDMPLGAQIMMLLVLMLSSKGMAGVARGSVVVVAA
IAPMFHLPPSGVVLILAIDQILDMGRTATNVIGNSIATAVIAKWEAKRAVKHIDGADSPA
LGRLQELRELQGETK