Protein Info for BPHYT_RS33240 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details PF02659: Mntp" amino acids 31 to 181 (151 residues), 185.3 bits, see alignment E=3.2e-59

Best Hits

Swiss-Prot: 100% identical to MNTP_PARPJ: Putative manganese efflux pump MntP (mntP) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6717)

MetaCyc: 57% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9B0 at UniProt or InterPro

Protein Sequence (189 amino acids)

>BPHYT_RS33240 membrane protein (Burkholderia phytofirmans PsJN)
MNPVATLFLAFAMSTDAFAAAIGKGATLNRPHWREAVRTGLIFGVIEALTPLVGWFLGKA
AAQYVSAWDHWIAFSLLLVLGARMVFNSFNTKEVEETKPSAHSFWLLALTGFATSIDAMA
VGAGLAFVDVNIYSTAAAIGLATMAMVTIGVMLGRVIGHVAGRRAELAGGIVLIGIGSTI
LAEHLNIFG