Protein Info for BPHYT_RS33235 in Burkholderia phytofirmans PsJN

Annotation: potassium transporter Kup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 410 to 433 (24 residues), see Phobius details amino acids 440 to 460 (21 residues), see Phobius details PF02705: K_trans" amino acids 29 to 563 (535 residues), 704.4 bits, see alignment E=4.6e-216

Best Hits

Swiss-Prot: 61% identical to KUP_NITMU: Probable potassium transport system protein kup (kup) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 100% identity to bpy:Bphyt_6716)

MetaCyc: 47% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9A9 at UniProt or InterPro

Protein Sequence (641 amino acids)

>BPHYT_RS33235 potassium transporter Kup (Burkholderia phytofirmans PsJN)
MSQSVSAAPDAGHSGGRGHHRPAMPALALAALGVVYGDIGTSPLYTLQTVFNPVNGLSLN
ALNVVGIVSLIVWSLIIVVSLKYVTLILRANNHGEGGIMALLALAASSVSARPRLRRTLL
GIGIMGAALFYGDSVITPAISVLSAVEGLEVAAPFLKTCVIPVTLVALVTLFLMQKHGTA
GIGIVFGPVMVLWFIVLAVAGVVNMMRAPAILVALNPLTGLAFCLHHRWLAFVALGAVVL
SLTGAEALYADMGHFGAKPIRLTWFGLVFPALALNYLGQGALLLADPGALQNPFYKLFPQ
WALYPMIVLSTVATVIASQAVISGTYSMTKQAMQLGFLPRMNVVYTSEREMGQIYVPGIN
WTLLAAVVAAVVGFGSSTALGSAYGIAVTGTMLITTILTFFVIRYAWHYNWFLCVFATGF
FFLIDAAFFSANLLKLMEGGWFPLLVGLIIYTIMATWGRGWEMMRAEARVRAGTTPLKPY
LATLLKESPIRCGGTAIFLSPDPDGVPHSLINNLMHNRVLHKRVVFVTVNNEEIPWVPAS
ERVSVHPLDSECYQVTITYGFMDEVDLPRALEVCRAYGLSFEPAETSYFLSRATLVPTRD
SGMAMWRERLFSVMLHNVGNVAAYLKLPANRVIELGARVEI