Protein Info for BPHYT_RS33210 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00005: ABC_tran" amino acids 50 to 179 (130 residues), 75.3 bits, see alignment E=4e-25

Best Hits

Swiss-Prot: 41% identical to RFBE_YEREN: O-antigen export system ATP-binding protein RfbE (rfbE) from Yersinia enterocolitica

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_6710)

MetaCyc: 46% identical to O antigen ABC transporter ATP-binding protein (Brucella abortus 2308)
TRANS-RXN2B4Q-125 [EC: 7.5.2.14]

Predicted SEED Role

"Polysaccharide ABC transporter, ATP-binding protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9A3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BPHYT_RS33210 ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MAHIQLTNATLDIPIYGVQGRSLKKRIASLRSRGAEVNKRPDTVILRAINDLTISIKAGD
RIGLIGHNGAGKSTLLRVMAGIYPPTAGSVETEGKSVPLLDISLGMDENSTGWQNMRLRG
LLLGMGEDEINEKQSEIAAFSELGDFLDLPIRTYSTGMKVRLGFAISTAVDAQILLLDEV
MGVGDASFKDKANRRLAELHERSEIVVLALHDNATIRKTCDKALWMDKGRAKMFGPAEEV
LEAYEASVSQSTA