Protein Info for BPHYT_RS33200 in Burkholderia phytofirmans PsJN

Annotation: acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 191 to 222 (32 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 353 (346 residues), 98.7 bits, see alignment E=1.8e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6708)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T9A1 at UniProt or InterPro

Protein Sequence (390 amino acids)

>BPHYT_RS33200 acyltransferase 3 (Burkholderia phytofirmans PsJN)
MSPTSDRNHALDGLRGVAAIIVVLSHAALFFYPALHGIGAASNLESAVFSSPIPILYAGN
FSVCVFFVLSGYVLSIKYSLTGDDTLVRGMFVKRYFRLMPAVLLVSLINCVLMKLGLMHN
QIATSSDWAHSFFNMPPSLIDATHEGMWTNFVSGASLPSYNPPAWTMRVEFFGSLLVFAV
CLLAKGNPFRWLVYILVMAAMYATTDRTGVCLSLFLVGMWIAEMPARSLSNSAAFVLVAM
SAYLGSYHPGSAFHQPITTAIAWLPIRWPLYVVNAIAATLAFYSVLCNAEIARIFERFSE
LGRRSYSFYLLHIGIFSSAGLWLFSWLADHFAPRPLAAGASTIFTILLTYLIAGPFTTWV
DEPAIRGSGVVLRFLSSKTQTRKTKDVYES