Protein Info for BPHYT_RS32845 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF01547: SBP_bac_1" amino acids 44 to 305 (262 residues), 62.5 bits, see alignment E=1.5e-20 PF13416: SBP_bac_8" amino acids 49 to 336 (288 residues), 108.3 bits, see alignment E=1.3e-34 PF13343: SBP_bac_6" amino acids 83 to 323 (241 residues), 66.2 bits, see alignment E=6.5e-22

Best Hits

Swiss-Prot: 48% identical to SPUD_PSEAB: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6638)

MetaCyc: 50% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T934 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BPHYT_RS32845 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MKIRHATLLSLAGTMLCSLTALTAMNAARAADTSLNVYNWSDYIAKDTIANFEKQSGVTV
KYDSYDSDDTLQAKLLAGSSGYDIVVPTSSYMARQIEAGVYQKIDKSKMPNLANLDPGLM
KLIADADPGNQYGVPWAWGTDGIGYNVQAVKQALGGEAPVDSWSLLFDPANLSKVKSCGV
SFLDSAADVFPAVLQYMHKNPNSTNPGDYQAAYEVLKKVRPYITQFNSSGYINDLANNDI
CVAFGFSGDVGIARRRASEAKRTYEVRFSNIKDAGLVWMDVMVIPKDAPHPEAAMKWMNY
IEDPKVSAEITNEVFYPTANRAARQFVTPAIEQDANVYPPEAVLNKMTLMRPQPAPIMRL
ENRLWAQLKSGN