Protein Info for BPHYT_RS32810 in Burkholderia phytofirmans PsJN

Annotation: xylose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 90 to 106 (17 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 349 to 362 (14 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 388 (328 residues), 135.4 bits, see alignment E=1.1e-43

Best Hits

Swiss-Prot: 54% identical to XYLH_HAEIN: Xylose transport system permease protein XylH (xylH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 100% identity to bpy:Bphyt_6630)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T926 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BPHYT_RS32810 xylose ABC transporter permease (Burkholderia phytofirmans PsJN)
MTPDVTSQRADEAVPRGAFGGPQRIQQLFARYKILALLIAVAAIWIFFSALTHGAFVTPR
NLSNLLRQMSITGMLACGMVFVIIAGEIDLSVGSLLGLLGGVAAILDVNRHWPIGVTLPV
VMLLGVLVGMFNGWWSTYRRVPSFIVGLGGMLAYRGILLGVTGGSTIAPVSDSFVFVGQG
YLPRLAGDTLAVVLFLLLAFLTIRQRRNRERYQLRVVPVWQDVVKVVGAGVILAGFVATL
DRYGGIPVPVLLLLALLGIFTWIATQTVFGRRIYAVGSNLEATRLSGVNTNRVKLAIFAL
MGLMCAFGGIVNTARLAAGSPSAGSMGELDAIAACFIGGTSMRGGSGTVYGALIGALVMA
SLDNGMSMLDVDAYWQMIVKGSILVLAVWIDVVSGSNRR