Protein Info for BPHYT_RS32550 in Burkholderia phytofirmans PsJN

Annotation: general secretion pathway protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF13401: AAA_22" amino acids 45 to 176 (132 residues), 80 bits, see alignment E=4.1e-26 PF09848: SLFN-g3_helicase" amino acids 49 to 140 (92 residues), 21.8 bits, see alignment E=2.2e-08 PF00004: AAA" amino acids 50 to 148 (99 residues), 22.4 bits, see alignment E=2.8e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to bxe:Bxe_A1121)

Predicted SEED Role

"General secretion pathway protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>BPHYT_RS32550 general secretion pathway protein A (Burkholderia phytofirmans PsJN)
MSQRLQALYGLKWNPFSPELPLEALYVPPRVENFCWRIENALVREGGFAMIHGEPGTGKS
VVMRVLAEKLERLTDLTVVSINHPQSNLADFYREMGDIFGLELRPHNRWGGFRSLRDRWM
SHLQSTRRRPILLIDEAQEMSPGVLNELRLMASARFDSQPLLCVVLAGDTRLTDKLRRDE
LLPLGSRIRSRLGTEKASADDLLACLEHLLASAGAPQLMTPPLRHTLCEHALGNYRVLTT
LANELLTTAAQRELSELDEKLYFEVFAPSTQSSRRTPARQPNGAR