Protein Info for BPHYT_RS32530 in Burkholderia phytofirmans PsJN

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF13007: LZ_Tnp_IS66" amino acids 36 to 110 (75 residues), 46.8 bits, see alignment E=7.9e-16 PF13005: zf-IS66" amino acids 118 to 162 (45 residues), 59.7 bits, see alignment 5.8e-20 PF03050: DDE_Tnp_IS66" amino acids 177 to 466 (290 residues), 306.4 bits, see alignment E=4.4e-95 PF13817: DDE_Tnp_IS66_C" amino acids 473 to 511 (39 residues), 55.1 bits, see alignment 1.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6577)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBD8 at UniProt or InterPro

Protein Sequence (518 amino acids)

>BPHYT_RS32530 transposase (Burkholderia phytofirmans PsJN)
MPPSSSSSTDELQALRAELAAMKGELRVVTVERDLLRERLKAYQRQLFASRSEVRGAEQR
DLFLNEAEALATGCEPAQETETEQSVEVGAHERKKRGRKPLNPMLPREVVRHELPESERV
CAHDGHALVEIGAEISEQLDIVPQQVRVIQHQRIKYACPCCDLGIKVTPAPSRIIPKGLL
TESALAWVIVSKFADALPLYRIAALLHRFGGDLSRGTLAASVVRVGMAVQPLINLMRDHL
LEADIVYGDETTVQVLKEPGRAAQRKSYMWAQMNGTGPPVRMFSYSPTRSAAQAAVLYAG
IKPGAVLMSDGYEPYNEIARTNQLVHLGCWAHARRYLIEAEEDLPKEQRGGNHPVSEFIR
LIGQLFAVEARSQDMTPEQRQQLRQARSQPVLDQIEALLSRHLNTVLPQSGFGKALQYLR
GQWPKLIRYVGNGAWPISNNPCENAIRPFTVGRRNWLFSDTVAGANAAANLYSLVQTCKA
NSIEPYQYLIALFKGLPHAHTADDYEALLPWRLNPNVA