Protein Info for BPHYT_RS32420 in Burkholderia phytofirmans PsJN

Annotation: selenocysteine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 14 to 472 (459 residues), 617.3 bits, see alignment E=8.3e-190 PF12390: Se-cys_synth_N" amino acids 14 to 52 (39 residues), 47.5 bits, see alignment 2.4e-16 PF03841: SelA" amino acids 89 to 459 (371 residues), 541.1 bits, see alignment E=2.1e-166 PF00266: Aminotran_5" amino acids 157 to 323 (167 residues), 32.8 bits, see alignment E=6e-12

Best Hits

Swiss-Prot: 60% identical to SELA_PSEAE: L-seryl-tRNA(Sec) selenium transferase (selA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to bpy:Bphyt_6556)

MetaCyc: 58% identical to selenocysteine synthase (Escherichia coli K-12 substr. MG1655)
L-seryl-tRNA(Sec) selenium transferase. [EC: 2.9.1.1]

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.9.1.1

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBB3 at UniProt or InterPro

Protein Sequence (476 amino acids)

>BPHYT_RS32420 selenocysteine synthase (Burkholderia phytofirmans PsJN)
MSDVSGSELRALMARVPSVEKVMASAEFAALLAEYGRTQVLGAVREALDTWRAGAQSGDA
SVSALDVAQLKSAVEAALRKRHESRLRSVFNLTGTVLHTNLGRALLPDEAVQAVMKALTQ
PANLEFDLGTGKRGDRDDLIDELICELTGAEAATVVNNNAAAVLLTLSALASKKEVIVSR
GELVEIGGAFRIPDIMSRAGAKLREVGTTNRTHLKDYEEAIGPQTALLMKVHASNYAISG
FTKEVGLNEIAPLAHARGLAVAVDLGSGTLVDLSQWGLPRETTVRETVEAGADLVTFSGD
KLLGGPQAGLIVGRRDLIAKIKKHPLKRALRVGKLTLAALEPVLQLYRAPERLTERLTTL
RLLTRAADDIRLAADRVQPALQHAVGERYAVTAEPMFSQIGSGALPVDVLPSYGLVVRMA
DGKRGGRQLLALEKMLREMARPVIGRIADDALRLDLRCLEAADEAQLVEQLKGARA