Protein Info for BPHYT_RS32415 in Burkholderia phytofirmans PsJN

Annotation: translation elongation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 TIGR00475: selenocysteine-specific translation elongation factor" amino acids 1 to 628 (628 residues), 441.1 bits, see alignment E=3.5e-136 PF00009: GTP_EFTU" amino acids 2 to 152 (151 residues), 108.5 bits, see alignment E=8.2e-35 PF03144: GTP_EFTU_D2" amino acids 193 to 259 (67 residues), 47.2 bits, see alignment E=6.2e-16 PF09106: SelB-wing_2" amino acids 443 to 498 (56 residues), 56.1 bits, see alignment 8.2e-19 PF21214: bact_SelB_WH_2nd" amino acids 526 to 566 (41 residues), 38 bits, see alignment 3e-13 PF09107: SelB-wing_3" amino acids 583 to 626 (44 residues), 49.7 bits, see alignment 5.3e-17

Best Hits

KEGG orthology group: K03833, selenocysteine-specific elongation factor (inferred from 100% identity to bpy:Bphyt_6555)

Predicted SEED Role

"Selenocysteine-specific translation elongation factor" in subsystem Selenocysteine metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBB2 at UniProt or InterPro

Protein Sequence (637 amino acids)

>BPHYT_RS32415 translation elongation factor (Burkholderia phytofirmans PsJN)
MIVGTAGHIDHGKTSLVKALSGVDTDRLKEEKARGISIELGYAYVPLENGDVLGLIDVPG
HEKLVHTMTAGASGIDFALLVIAADDGVMPQTREHLAIVELLGIRQGAVALTKVDRVDAQ
RLREVHDEVRAFLSGSVLQDAPVFDTCAVQADDPGVAALKAHLHAAAAAWRMKRDDGLFR
LAVDRVFTLSGQGTIVTGTVVSGRVAVGDTMLLAPKNQPVRVRSIHAQNRPAQSGRAGER
CALNLAGIEKSAIDRGDWIVDPRLSQASERIDVMLTLLADAPHALEHWAPLHVHLGTQHQ
VAHVALLDGETLGAGRRARVQLVFERPVCALPGDRFVVRNAQANRTIGGGHVLDPFAPSR
KRRSVERLAWLDALQTMLDTATLDAIFARAPHGLSRSLLERLTGMPAATLALPANTRVVE
LPGEDALLVADALWQALNSRLTATLAQYHERSPDELGPDISRLRRIAAPLVDDALWRALV
DDAATRGEIVKRGPWLHLPGHAVTLDEADRALAATLLPAVKAGGFDPPWVRDLANAHGVP
EERVRQLMRKLARQGELFQVVRDLFYHPQMIRELASIAAAEAQKNAGTVAAAPFRDVTGL
GRKRAIQLLEFFDRVGYTRFHRGLHLLRTDSRWLDLL